Press Release Summary = Today AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced fourteen (14) new peptides for drug discovery research.
Press Release Body = July 24, 2007 - San Jose, CA
Today AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced fourteen (14) new peptides for drug discovery research.
HIV Nef (68-76) - Cat# 61673 This HIV nef peptide 68 to 76 amino acids was identified in HIV-infected individuals. It is a B7 restricted epitope and a high affinity HLA binder. Sequence: FPVTPQVPL
Substance P (1-6); amide - Cat# 61690 Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This peptide is 1 to 6 amino acid fragment of SP. This peptide is one of the products of SP hydrolysis by kidney endopeptidase. Sequence: RPKPQQ-NH2
Substance P (1-7); amide - Cat# 61691 Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This bioactive N-terminal fragment 1 to 7 amino acid of substance P is generated by substance P endopeptidase; a predominantly cytosolic enzyme. Sequence: RPKPQQF-NH2
Substance P (5-11); amide - Cat# 61692 Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This is fragment 5 to 11 amino acids of substance P. Sequence: QQFFGLM-NH2
Substance P (8-11) - Cat# 61694 Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This SP fragment 8 to 11 amino acids was used in the healing of corneal epithelial wounds study. The combination of FGLM-NH2 and IGF-1 promotes corneal epithelial wound healing in diabetic rats; suggesting that this kind of treatment might prove effective in humans with diabetic keratopathy. Administration of eyedrops containing both FGLM-NH2 and SSSR is effective for the treatment of persistent epithelial defects in individuals with neurotrophic keratopathy. Sequence: FGLM-NH2
Substance P (9-11) - Cat# 61695 Substance P (SP) is an important neuropeptide that has been implicated in several physiological processes. This is a SP peptide fragment 9 to 11 amino acid. It is also a common C-terminal tachykinin motif. Sequence: GLM-NH2
Influenza Virus A/Aichi/2/68 Haemagglutinin HA1 (195-209); X-31 - Cat# 61696 This is fragment 195 to 209 amino acid from the early Hong Kong influenza virus A/Aichi/2/68 (X-31). The complete amino acid sequence (328 residues) of variant-A/Aichi/68 HA`1 was compared to A/Memphis/72 haemagglutinins; and the study has revealed several differences in structure. The monosaccharide compositions of the individual carbohydrate units on variant-A/Aichi/68 haemagglutinin differ from those of the corresponding units in variant-A/Memphis/72 haemagglutinin. Sequence: YVQASGRVTVSTRRS
Influenza Virus NP (55-69) - Cat# 61698 This is the influenza virus nucleoprotein peptide residues 55 to 69 representing a T-helper epitope from nucleoprotein. Sequence: RLIQNSLTIERMVLS
LMP1 (125-133); Latent Membrane Potein (125-133); YLL; minimal epitope - Cat# 61675 This 9 amino acids HLA A2-restricted epitope is the minimal sequence that detects the Epstein-Barr virus (EBV)-encoded oncogene latent membrane protein (LMP) 1; which is consistently expressed in multiple EBV-associated malignancies. Analysis of YLLEMLWRL-specific cytotoxic T lymphocytes (CTLs) revealed that these lymphocytes are able to lyse EBV-infected B cells expressing different HLA A2 supertype alleles including A*0201; A*0202; A*0203; A*0204; A*0206; A*6802 and A*6901. Sequence: YLLEMLWRL
LMP 1 (46-62); Latent Membrane Protein (46-62) - Cat# 61677 This 46 to 62 amino acid peptide from the Epstein-Barr virus (EBV)-encoded oncogene latent membrane protein (LMP) 1 was derived from the seropositive virus carriers. It shows CD8+ T-cell-dependent reactivity. Sequence: DWTGGALLVLYSFALML
LMP1 (51-59); Latent Membrane Protein (51-59); All - Cat# 61680 This peptide is a fragment of the Epstein-Barr virus (EBV)-encoded oncogene latent membrane protein (LMP) 1; codon 51 to 59. It is a HLA A2-restricted epitope; which is highly conserved in virus isolates from Caucasian; African; and Southeast Asian donors. Sequence: ALLVLYSFA
LL-37; reverse sequence - Cat# 62208 The reverse sequence of LL-37 (see Cat# 61302). Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Peptide Substrate for Renin 520 Assay kit - Cat# 61872 This FRET peptide is a specific substrate for renin; the aspartyl protease that cleaves the angiotensinogen to yield angiotensin I that is converted to the angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function that governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening of renin inhibitors and renin activity. In the FRET peptide the fluorescence of 5-FAM is quenched by QXLT520. Upon cleavage into two separate fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission
Web Site = http://www.anaspec.com
Contact Details = 2149 O\'toole Ave. San Jose, CA 95131 1-408-452-5055 ping@anaspec.com
2025
